Loading...
Statistics
Advertisement

84772.xyz - Diese Website steht zum Verkauf! - Informationen zum ...
www.84772.xyz/
Diese Website steht zum Verkauf! 84772.xyz ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen ...

84772.xyz

Advertisement
84772.xyz is hosted in United States / Cambridge . 84772.xyz uses HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Html5, Number of used javascripts: 4. First javascripts: Jquery-1.4.2.min.js, Caf.js, Iam.js, Number of used analytics tools: 0. Its server type is: Apache/2.2.22 (Debian).

Technologies in use by 84772.xyz

Technology

Number of occurences: 6
  • CSS
  • Html
  • Html5
  • Javascript
  • Php
  • SVG

Advertisement

Javascripts

Number of occurences: 4
  • jquery-1.4.2.min.js
  • caf.js
  • iam.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Apache/2.2.22 (Debian)

Powered by

  • PHP/5.6.25-1~dotdeb.7.1

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - 84772.xyz

SSL certificate

    • name: /OU=Domain Control Validated/CN=cc.sedoparking.com
    • subject:
      • OU: Domain Control Validated
      • CN: cc.sedoparking.com
    • hash: 75a61910
    • issuer:
      • C: BE
      • O: GlobalSign nv-sa
      • CN: GlobalSign Domain Validation CA - SHA256 - G2
    • version: 2
    • serialNumber: 1492334156563186506134045474198837599565904
    • validFrom: 151111084540Z
    • validTo: 171111084540Z
    • validFrom_time_t: 1447231540
    • validTo_time_t: 1510389940
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • certificatePolicies: Policy: 2.23.140.1.2.1 CPS: https://www.globalsign.com/repository/
      • subjectAltName: DNS:cc.sedoparking.com
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • crlDistributionPoints: Full Name: URI:http://crl.globalsign.com/gs/gsdomainvalsha2g2.crl
      • authorityInfoAccess: CA Issuers - URI:http://secure.globalsign.com/cacert/gsdomainvalsha2g2r1.crt OCSP - URI:http://ocsp2.globalsign.com/gsdomainvalsha2g2
      • subjectKeyIdentifier: 0E:6F:EB:0F:FC:4B:CA:2F:04:C5:FE:DC:1B:B8:A5:5F:31:E1:C3:6A
      • authorityKeyIdentifier: keyid:EA:4E:7C:D4:80:2D:E5:15:81:86:26:8C:82:6D:C0:98:A4:CF:97:0F

Meta - 84772.xyz

Number of occurences: 5
  • Name:
    Content: 0; URL=http://www.84772.xyz//?gtnjs=1
  • Name: expires
    Content: NOW
  • Name: GOOGLEBOT
    Content: index, follow, all
  • Name: robots
    Content: index, follow, all
  • Name: description
    Content: Diese Website steht zum Verkauf! 84772.xyz ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf 84772.xyz alles. Wir hoffen, dass Sie hier das Gesuchte finden!

Server / Hosting

  • IP: 72.52.4.90
  • Latitude: 42.36
  • Longitude: -71.08
  • Country: United States
  • City: Cambridge

Rname

  • ns1.sedoparking.com
  • ns2.sedoparking.com
  • localhost

Target

  • hostmaster.sedo.de

HTTP Header Response

HTTP/1.1 200 OK Date: Fri, 30 Sep 2016 12:46:22 GMT Server: Apache/2.2.22 (Debian) X-Powered-By: PHP/5.6.25-1~dotdeb.7.1 Expires: Mon, 26 Jul 1997 05:00:00 GMT Last-Modified: Fri, 30 Sep 2016 12:46:22 GMT Cache-Control: no-store, no-cache, must-revalidate Cache-Control: post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: tu=3e23e3ca438b0c77928c58c071047029; expires=Tue, 31-Dec-2019 23:00:00 GMT; Max-Age=102593618; path=/; domain=84772.xyz; httponly X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBANnylWw2vLY4hUn9w06zQKbhKBfvjFUCsdFlb6TdQhxb9RXWXuI4t31c+o8fYOv/s8q1LGPga3DE1L/tHU4LENMCAwEAAQ==_m7jOK8bZ6b/uHtnUptK6w3P4b9V1gg6JQMf3wm0PwnJgqo1jXC5JdBWtk+lL3aYZwTN3Z6LqQYmgutBuk14RCA== Vary: Accept-Encoding Content-Type: text/html; charset=UTF-8 X-Cache: MISS from 660666 Set-Cookie: NSC_tfep-83+63+5+01-91=ffffffff516a73d445525d5f4f58455e445a4a423660;path=/;httponly X-Cache: MISS from s_hv897 Transfer-Encoding: chunked Via: 1.1 s_hv897 (squid/3.5.20) Connection: keep-alive

DNS

host: 84772.xyz
  1. class: IN
  2. ttl: 600
  3. type: A
  4. ip: 72.52.4.90
host: 84772.xyz
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.sedoparking.com
host: 84772.xyz
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.sedoparking.com
host: 84772.xyz
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.sedoparking.com
  5. rname: hostmaster.sedo.de
  6. serial: 2015071001
  7. refresh: 86400
  8. retry: 10800
  9. expire: 604800
  10. minimum-ttl: 86400
host: 84772.xyz
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 0
  5. target: localhost
host: 84772.xyz
  1. class: IN
  2. ttl: 3600
  3. type: TXT
  4. txt: v=spf1 ip6:fd92:59f3:510e::/48 -all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.4772.xyz, www.8y4772.xyz, www.y4772.xyz, www.8u4772.xyz, www.u4772.xyz, www.8i4772.xyz, www.i4772.xyz, www.864772.xyz, www.64772.xyz, www.8772.xyz, www.84w772.xyz, www.8w772.xyz, www.84q772.xyz, www.8q772.xyz, www.84t772.xyz, www.8t772.xyz, www.84e772.xyz, www.8e772.xyz, www.84r772.xyz, www.8r772.xyz, www.842772.xyz, www.82772.xyz, www.8472.xyz, www.847t72.xyz, www.84t72.xyz, www.847z72.xyz, www.84z72.xyz, www.847y72.xyz, www.84y72.xyz, www.847u72.xyz, www.84u72.xyz, www.847572.xyz, www.84572.xyz, www.8472.xyz, www.8477t2.xyz, www.847t2.xyz, www.8477z2.xyz, www.847z2.xyz, www.8477y2.xyz, www.847y2.xyz, www.8477u2.xyz, www.847u2.xyz, www.847752.xyz, www.84752.xyz, www.8477.xyz, www.847720.xyz, www.84770.xyz, www.84772q.xyz, www.8477q.xyz, www.84772w.xyz, www.8477w.xyz,

Other websites we recently analyzed

  1. The Empire State Relief Fund: Restore, Rebuild, Return
    Ashburn (United States) - 23.21.206.114
    Server software: Microsoft-IIS/7.5
    Technology: CloudFront, CSS, Html, Html5, Iframe, Javascript, Php, New Relic, Add This, Facebook Like box
    Number of Javascript: 6
    Number of meta tags: 2
  2. Recruitment Worcester - Step by Step Recruitment
    United Kingdom - 79.170.40.55
    Server software: Apache/2.4.18 (Unix)
    Technology: CSS, Html, Javascript, jQuery, jQuery Cycle, jQuery Validate, Php, Pingback, Google Analytics, Wordpress
    Number of Javascript: 21
    Number of meta tags: 6
  3. gonzabaemployment.com
    Ashburn (United States) - 54.210.220.177
    Server software:
    Technology: CSS, Html, Javascript, jQuery UI
    Number of Javascript: 3
  4. boisdechauffage64.fr
    Germany - 217.160.233.89
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, jQuery, Wordpress
    Number of Javascript: 2
    Number of meta tags: 2
  5. bbsdxjx.com
    Scottsdale (United States) - 184.168.221.33
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  6. thetampatrafficticketlawfirm.com
    Scottsdale (United States) - 184.168.221.45
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  7. TheStationeryCentre | All Your Stationery Needs In One Place At Competitive Prices!
    Providence (United States) - 209.236.71.112
    Server software: Apache
    Technology: Carousel, CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, Shortcodes, Wordpress
    Number of Javascript: 24
    Number of meta tags: 5
  8. RMG
    Jakarta (Indonesia) - 202.67.9.90
    Server software: LiteSpeed
    Technology: Carousel, CSS, Fancybox, Html, Html5, jQuery Fancybox, jQuery Validate, Php
    Number of Javascript: 6
    Number of meta tags: 4
  9. univerely.review
    Austin (United States) - 209.99.40.226
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  10. Capital Solutions Group, Inc.
    Check out this GoDaddy hosted webpage! http://csgrp.net.
    Scottsdale (United States) - 97.74.42.79
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Javascript, jQuery, jQuery UI
    Number of Javascript: 4
    Number of meta tags: 3

Check Other Websites